Human Monoclonal Laboratories manufactures the human monoclonal mabs reagents distributed by Genprice. The Human Monoclonal Mabs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Mabs
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Mabs information
FITC*Monoclonal Mouse Anti- Human FC |
C030602-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human FC |
C030602-1ml |
Unibiotest |
1ml |
EUR 424.8 |
anti-XPA (human) antibody, monoclonal |
70-031 |
Sceti |
50ug |
EUR 496.8 |
Description: The anti-XPA (human) antibody, monoclonal is available in Europe and for worldwide shipping via Gentaur. |
Midkine (MK) Monoclonal Antibody (Human) |
4-MAA631Hu22 |
Cloud-Clone |
-
EUR 289.20
-
EUR 2900.40
-
EUR 724.80
-
EUR 361.20
-
EUR 253.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Midkine (MK) |
Leptin (LEP) Monoclonal Antibody (Human) |
4-MAA084Hu21 |
Cloud-Clone |
-
EUR 285.60
-
EUR 2845.20
-
EUR 711.60
-
EUR 356.40
-
EUR 252.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |
Leptin (LEP) Monoclonal Antibody (Human) |
4-MAA084Hu22 |
Cloud-Clone |
-
EUR 285.60
-
EUR 2845.20
-
EUR 711.60
-
EUR 356.40
-
EUR 252.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |
HRP*Monoclonal Mouse Anti- Human IgG2 |
C030245-10ml |
Unibiotest |
10ml |
EUR 3162 |
HRP*Monoclonal Mouse Anti- Human IgG2 |
C030245-1ml |
Unibiotest |
1ml |
EUR 525.6 |
HRP*Monoclonal Mouse Anti- Human IgG3 |
C030246-10ml |
Unibiotest |
10ml |
EUR 3162 |
HRP*Monoclonal Mouse Anti- Human IgG3 |
C030246-1ml |
Unibiotest |
1ml |
EUR 525.6 |
HRP*Monoclonal Mouse Anti- Human IgG4 |
C030247-10ml |
Unibiotest |
10ml |
EUR 3162 |
HRP*Monoclonal Mouse Anti- Human IgG4 |
C030247-1ml |
Unibiotest |
1ml |
EUR 525.6 |
HRP*Monoclonal Mouse Anti- Human IgG1 |
C030248-10ml |
Unibiotest |
10ml |
EUR 3162 |
HRP*Monoclonal Mouse Anti- Human IgG1 |
C030248-1ml |
Unibiotest |
1ml |
EUR 525.6 |
FITC*Monoclonal Mouse Anti- Human IgM |
C030601-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human IgM |
C030601-1ml |
Unibiotest |
1ml |
EUR 424.8 |
FITC*Monoclonal Mouse Anti- Human Fab |
C030603-10ml |
Unibiotest |
10ml |
EUR 2148 |