Human Monoclonal Mabs

p53 Rabbit mAbs 1mL - EACH
RM-9105-S EACH
EUR 992.25

Human Monoclonal Laboratories manufactures the human monoclonal mabs reagents distributed by Genprice. The Human Monoclonal Mabs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Mabs

True Blue Chloride
100mg
EUR 11200
Description: 71431-30-6

JBS True Blue
300 µl
EUR 16
Description: JBS True Blue

Monoclonal PP2A alpha and beta Antibody
0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Mabs information

Human CD5 Monoclonal antibody
5F-100T 100 test
EUR 221.1

Human CD5 Monoclonal antibody
5F1-100T 100 test
EUR 204.6

Human CD5 Monoclonal antibody
5PE1-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody
5PPC5.51-100T 100 test
EUR 292.6

Human CD6 Monoclonal antibody
6A-100T 100 test
EUR 259.6

Human CD6 Monoclonal antibody
6F-100T 100 test
EUR 215.6

Human CD6 Monoclonal antibody
6PE-100T 100 test
EUR 259.6

Human CD2 Monoclonal antibody
2A-100T 100 test
EUR 259.6

Human CD2 Monoclonal antibody
2F-100T 100 test
EUR 215.6

Human CD2 Monoclonal antibody
2PE-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody
3A1-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody
3AC750-100T 100 test
EUR 325.6

Human CD3 Monoclonal antibody
3CFB1-100T 100 test
EUR 292.6

Human CD3 Monoclonal antibody
3F1-100T 100 test
EUR 215.6

Human CD3 Monoclonal antibody
3PE1-100T 100 test
EUR 302.5

Human CD3 Monoclonal antibody
3PPC5.5-100T 100 test
EUR 292.6

Human CD4 Monoclonal antibody
4A-100T 100 test
EUR 259.6