Human Monoclonal Mabs

p53 Rabbit mAbs 1mL - EACH

RM-9105-S EACH
EUR 992.25

Human Monoclonal Laboratories manufactures the human monoclonal mabs reagents distributed by Genprice. The Human Monoclonal Mabs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Mabs

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Phosphotyrosine Antibody (Set of 5 MAbs)

1 set Ask for price

Keratin Pan Mouse mAbs 7mL - EACH

EACH
EUR 290.25

Estrogen R Rabbit mAbs 1mL - EACH

EACH
EUR 2565

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Mabs information

Human CD9 Monoclonal antibody

9CFB-100T 100 test
EUR 292.6

Human CD9 Monoclonal antibody

9F-100T 100 test
EUR 215.6

Human CD9 Monoclonal antibody

9PE-100T 100 test
EUR 259.6

Human CD9 Monoclonal antibody

9PU-01MG 0,1 mg
EUR 149.6

Human CD2 Monoclonal antibody

2A-100T 100 test
EUR 259.6

Human CD2 Monoclonal antibody

2F-100T 100 test
EUR 215.6

Human CD2 Monoclonal antibody

2PE-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody

3A1-100T 100 test
EUR 259.6

Human CD3 Monoclonal antibody

3AC750-100T 100 test
EUR 325.6

Human CD3 Monoclonal antibody

3CFB1-100T 100 test
EUR 292.6

Human CD3 Monoclonal antibody

3F1-100T 100 test
EUR 215.6

Human CD3 Monoclonal antibody

3PE1-100T 100 test
EUR 302.5

Human CD3 Monoclonal antibody

3PPC5.5-100T 100 test
EUR 292.6

Human CD6 Monoclonal antibody

6A-100T 100 test
EUR 259.6

Human CD6 Monoclonal antibody

6F-100T 100 test
EUR 215.6

Human CD6 Monoclonal antibody

6PE-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody

5A-100T 100 test
EUR 276.1